FAM129A Blocking Peptide (33R-8947)
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM129A antibody, catalog no. 70R-1294
Overview
Overview
| Synonyms | FAM129A control peptide, FAM129A antibody Blocking Peptide, Anti-FAM129A Blocking Peptide, Family With Sequence Similarity 129 Member A Blocking Peptide, C1orf24 Blocking Peptide, FLJ38228 Blocking Peptide, NIBAN Blocking Peptide, FAM129, FAM-129, FAM 129, FAM-129 Blocking Peptide, FAM 129 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE |
|---|---|
| Molecular Weight | 103 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product