FAM129A Blocking Peptide (33R-8947)

A synthetic peptide for use as a blocking control in assays to test for specificity of FAM129A antibody, catalog no. 70R-1294

Synonyms FAM129A control peptide, FAM129A antibody Blocking Peptide, Anti-FAM129A Blocking Peptide, Family With Sequence Similarity 129 Member A Blocking Peptide, C1orf24 Blocking Peptide, FLJ38228 Blocking Peptide, NIBAN Blocking Peptide, FAM129, FAM-129, FAM 129, FAM-129 Blocking Peptide, FAM 129 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE
Molecular Weight 103 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors