FAM131C antibody (70R-4271)

Rabbit polyclonal FAM131C antibody raised against the middle region of FAM131C

Synonyms Polyclonal FAM131C antibody, Anti-FAM131C antibody, C1orf117 antibody, FAM-131 antibody, FAM 131, Family With Sequence Similarity 131 Member C antibody, RP11-5P18.9 antibody, FAM 131 antibody, FAM-131, FAM131, FLJ36766 antibody
Specificity FAM131C antibody was raised against the middle region of FAM131C
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen FAM131C antibody was raised using the middle region of FAM131C corresponding to a region with amino acids RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF
Assay Information FAM131C Blocking Peptide, catalog no. 33R-7936, is also available for use as a blocking control in assays to test for specificity of this FAM131C antibody


Western Blot analysis using FAM131C antibody (70R-4271)

FAM131C antibody (70R-4271) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 30 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM131C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM131 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM131C antibody (70R-4271) | FAM131C antibody (70R-4271) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors