FAM135B antibody (70R-3897)

Rabbit polyclonal FAM135B antibody raised against the middle region of FAM135B

Synonyms Polyclonal FAM135B antibody, Anti-FAM135B antibody, FAM-135, MGC126009 antibody, MGC33221 antibody, FAM-135 antibody, Family With Sequence Similarity 135 Member B antibody, FAM 135 antibody, FAM 135, MGC126010 antibody, FAM135, C8ORFK32 antibody
Specificity FAM135B antibody was raised against the middle region of FAM135B
Cross Reactivity Human, Rat
Applications WB
Immunogen FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
Assay Information FAM135B Blocking Peptide, catalog no. 33R-9192, is also available for use as a blocking control in assays to test for specificity of this FAM135B antibody

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 156 kDa (MW of target protein)
Form & Buffer Supplied as liquid, in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM135 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €331.29
Size: 50 ug
OR
Shipping
View Our Distributors