Polyclonal FAM135B antibody, Anti-FAM135B antibody, FAM-135, MGC126009 antibody, MGC33221 antibody, FAM-135 antibody, Family With Sequence Similarity 135 Member B antibody, FAM 135 antibody, FAM 135, MGC126010 antibody, FAM135, C8ORFK32 antibody
Specificity
FAM135B antibody was raised against the middle region of FAM135B
Cross Reactivity
Human, Rat
Applications
WB
Immunogen
FAM135B antibody was raised using the middle region of FAM135B corresponding to a region with amino acids TLVSTGLWLMQKLKKSGSLLQLTFRDNADLRKCFLYQLSQKTGLQYFKNV
Assay Information
FAM135B Blocking Peptide, catalog no. 33R-9192, is also available for use as a blocking control in assays to test for specificity of this FAM135B antibody