FAM161A Blocking Peptide (33R-7992)
A synthetic peptide for use as a blocking control in assays to test for specificity of FAM161A antibody, catalog no. 70R-10073
Overview
Overview
| Synonyms | FAM161A control peptide, FAM161A antibody Blocking Peptide, Anti-FAM161A Blocking Peptide, family with sequence similarity 161, member A Blocking Peptide, FLJ13305 Blocking Peptide, MGC129982 Blocking Peptide, MGC129983 Blocking Peptide, FAM161A, FAMA-161, FAMA 161, FAMA-161 Blocking Peptide, FAMA 161 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RKEWVPTITVPEPFQMMIREQKKKEESMKSKSDIEMVHKALKKQEEDPEY |
|---|---|
| Molecular Weight | 65 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene belongs to the FAM161 family. It is expressed mainly in the retina. Mouse studies suggested that this gene is involved in development of retinal progenitors during embryogenesis, and that its activity is restricted to mature photoreceptors after birth. Mutations in this gene cause autosomal recessive retinitis pigmentosa-28. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product