FAM45B antibody (70R-3653)

Rabbit polyclonal FAM45B antibody raised against the middle region of FAM45B

Synonyms Polyclonal FAM45B antibody, Anti-FAM45B antibody, FAM-45 antibody, HT011 antibody, Family With Sequence Similarity 45 Member A Pseudogene antibody, FAM-45, FAM 45, FAM 45 antibody, FAM45
Specificity FAM45B antibody was raised against the middle region of FAM45B
Cross Reactivity Human
Applications WB
Immunogen FAM45B antibody was raised using the middle region of FAM45B corresponding to a region with amino acids AEDPEKSESQVIQDIALKTREIFTNLAPFSEVSADGEKRVLNLEALKQKR
Assay Information FAM45B Blocking Peptide, catalog no. 33R-1121, is also available for use as a blocking control in assays to test for specificity of this FAM45B antibody


Western Blot analysis using FAM45B antibody (70R-3653)

FAM45B antibody (70R-3653) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM45B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM45 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM45B antibody (70R-3653) | FAM45B antibody (70R-3653) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors