FAM46C antibody (70R-3947)

Rabbit polyclonal FAM46C antibody raised against the middle region of FAM46C

Synonyms Polyclonal FAM46C antibody, Anti-FAM46C antibody, FLJ20202 antibody, Family With Sequence Similarity 46 Member C antibody, FAM-46, FAM 46 antibody, FAM-46 antibody, FAM 46, FAM46
Specificity FAM46C antibody was raised against the middle region of FAM46C
Cross Reactivity Human
Applications WB
Immunogen FAM46C antibody was raised using the middle region of FAM46C corresponding to a region with amino acids LIATKNPEEIRGGGLLKYSNLLVRDFRPTDQEEIKTLERYMCSRFFIDFP
Assay Information FAM46C Blocking Peptide, catalog no. 33R-5037, is also available for use as a blocking control in assays to test for specificity of this FAM46C antibody


Western Blot analysis using FAM46C antibody (70R-3947)

FAM46C antibody (70R-3947) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM46C antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FAM46C belongs to the FAM46 family. The exact function of FAM46C remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM46C antibody (70R-3947) | FAM46C antibody (70R-3947) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €309.90
Size: 50 ug
View Our Distributors