FAM46D antibody (70R-4172)

Rabbit polyclonal FAM46D antibody raised against the middle region of FAM46D

Synonyms Polyclonal FAM46D antibody, Anti-FAM46D antibody, FAM 46 antibody, FAM-46, FAM-46 antibody, Family With Sequence Similarity 46 Member D antibody, FAM46, MGC26999 antibody, FAM 46
Specificity FAM46D antibody was raised against the middle region of FAM46D
Cross Reactivity Human
Applications WB
Immunogen FAM46D antibody was raised using the middle region of FAM46D corresponding to a region with amino acids LPNTQKVTCFYQPAPYFAAEARYPIYVIPEPPPVSFQPYHPLHFRGSNGM
Assay Information FAM46D Blocking Peptide, catalog no. 33R-5277, is also available for use as a blocking control in assays to test for specificity of this FAM46D antibody


Western Blot analysis using FAM46D antibody (70R-4172)

FAM46D antibody (70R-4172) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM46D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of FAM46D is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM46D antibody (70R-4172) | FAM46D antibody (70R-4172) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors