FAM55D antibody (70R-1827)

Rabbit polyclonal FAM55D antibody raised against the C terminal of FAM55D

Synonyms Polyclonal FAM55D antibody, Anti-FAM55D antibody, FAM 55, FAM55, FAM-55, FAM-55 antibody, FAM 55 antibody, C11orf33 antibody, Family With Sequence Similarity 55 Member D antibody, FLJ20127 antibody
Specificity FAM55D antibody was raised against the C terminal of FAM55D
Cross Reactivity Human,Rat,Dog
Applications IHC, WB
Immunogen FAM55D antibody was raised using the C terminal of FAM55D corresponding to a region with amino acids TYSVKEMEYLTRAIDRTGGEKNTVIVISLGQHFRPFPIDVFIRRALNVHK
Assay Information FAM55D Blocking Peptide, catalog no. 33R-9404, is also available for use as a blocking control in assays to test for specificity of this FAM55D antibody


Western Blot analysis using FAM55D antibody (70R-1827)

FAM55D antibody (70R-1827) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 60 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FAM55D antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM55 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM55D antibody (70R-1827) | FAM55D antibody (70R-1827) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors