FAM63A antibody (70R-4312)

Rabbit polyclonal FAM63A antibody raised against the middle region of FAM63A

Synonyms Polyclonal FAM63A antibody, Anti-FAM63A antibody, Family With Sequence Similarity 63 Member A antibody, FAM63, FAM-63 antibody, FAM 63, FLJ11280 antibody, FLJ43504 antibody, RP11-316M1.5 antibody, FAM-63, FAM 63 antibody
Specificity FAM63A antibody was raised against the middle region of FAM63A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM63A antibody was raised using the middle region of FAM63A corresponding to a region with amino acids LQQEEYQQQQAAQPVRMRTRVLSLQGRGATSGRPAGERRQRPKHESDCIL
Assay Information FAM63A Blocking Peptide, catalog no. 33R-5328, is also available for use as a blocking control in assays to test for specificity of this FAM63A antibody

Images

Western Blot analysis using FAM63A antibody (70R-4312)

FAM63A antibody (70R-4312) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM63A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of FAM63 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FAM63A antibody (70R-4312) | FAM63A antibody (70R-4312) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors