FAM98B antibody (70R-4262)

Rabbit polyclonal FAM98B antibody raised against the N terminal of FAM98B

Synonyms Polyclonal FAM98B antibody, Anti-FAM98B antibody, FAM 98, FAM-98, FAM-98 antibody, FLJ38426 antibody, FAM98, Family With Sequence Similarity 98 Member B antibody, FAM 98 antibody
Specificity FAM98B antibody was raised against the N terminal of FAM98B
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FAM98B antibody was raised using the N terminal of FAM98B corresponding to a region with amino acids LTKAAEGGLSSPEFSELCIWLGSQIKSLCNLEESITSAGRDDLESFQLEI
Assay Information FAM98B Blocking Peptide, catalog no. 33R-5476, is also available for use as a blocking control in assays to test for specificity of this FAM98B antibody


Western Blot analysis using FAM98B antibody (70R-4262)

FAM98B antibody (70R-4262) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FAM98B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of FAM98B is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FAM98B antibody (70R-4262) | FAM98B antibody (70R-4262) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors