FANCE antibody (70R-2296)

Rabbit polyclonal FANCE antibody raised against the middle region of FANCE

Synonyms Polyclonal FANCE antibody, Anti-FANCE antibody, FACE antibody, Fanconi Anemia Complementation Group E antibody, FAE antibody
Specificity FANCE antibody was raised against the middle region of FANCE
Cross Reactivity Human
Applications WB
Immunogen FANCE antibody was raised using the middle region of FANCE corresponding to a region with amino acids SPQAPDPEEEENRDSQQPGKRRKDSEEEAASPEGKRVPKRLRCWEEEEDH
Assay Information FANCE Blocking Peptide, catalog no. 33R-8689, is also available for use as a blocking control in assays to test for specificity of this FANCE antibody

Images

Western Blot analysis using FANCE antibody (70R-2296)

FANCE antibody (70R-2296) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FANCE antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FANCE antibody (70R-2296) | FANCE antibody (70R-2296) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €324.59
Size: 50 ug
OR
Shipping
View Our Distributors