FANCL antibody (70R-3410)

Rabbit polyclonal FANCL antibody raised against the middle region of FANCL

Synonyms Polyclonal FANCL antibody, Anti-FANCL antibody, POG antibody, FAAP43 antibody, PHF9 antibody, Fanconi Anemia Complementation Group L antibody, FLJ10335 antibody
Specificity FANCL antibody was raised against the middle region of FANCL
Cross Reactivity Human
Applications WB
Immunogen FANCL antibody was raised using the middle region of FANCL corresponding to a region with amino acids ASGREHLITLKLKAKYPAESPDYFVDFPVPFCASWTPQVNSPQSSLISIY
Assay Information FANCL Blocking Peptide, catalog no. 33R-1506, is also available for use as a blocking control in assays to test for specificity of this FANCL antibody


Western Blot analysis using FANCL antibody (70R-3410)

FANCL antibody (70R-3410) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FANCL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FANCL antibody (70R-3410) | FANCL antibody (70R-3410) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors