FARS2 antibody (70R-1396)

Rabbit polyclonal FARS2 antibody raised against the N terminal of FARS2

Synonyms Polyclonal FARS2 antibody, Anti-FARS2 antibody, PheRS antibody, Phenylalanyl-tRNA Synthetase 2 Mitochondrial antibody, dJ520B18.2 antibody, HSPC320 antibody, FARS1 antibody
Specificity FARS2 antibody was raised against the N terminal of FARS2
Cross Reactivity Human
Applications IHC, WB
Immunogen FARS2 antibody was raised using the N terminal of FARS2 corresponding to a region with amino acids VELLGKSYPQDDHSNLTRKVLTRVGRNLHNQQHHPLWLIKERVKEHFYKQ
Assay Information FARS2 Blocking Peptide, catalog no. 33R-9501, is also available for use as a blocking control in assays to test for specificity of this FARS2 antibody


Immunohistochemical staining using FARS2 antibody (70R-1396)

FARS2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FARS2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. FARS2 is a phenylalanine-tRNA synthetase (PheRS) localized to the mitochondrion which consists of a single polypeptide chain, unlike the (alpha-beta)2 structure of the prokaryotic and eukaryotic cytoplasmic forms of PheRS. Structure analysis and catalytic properties indicate mitochondrial PheRSs may constitute a class of PheRS distinct from the enzymes found in prokaryotes and in the eukaryotic cytoplasm.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FARS2 antibody (70R-1396) | FARS2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X
  • Western Blot analysis using FARS2 antibody (70R-1396) | FARS2 antibody (70R-1396) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
View Our Distributors