FASTKD2 antibody (70R-3176)

Rabbit polyclonal FASTKD2 antibody raised against the middle region of FASTKD2

Synonyms Polyclonal FASTKD2 antibody, Anti-FASTKD2 antibody, Fast Kinase Domains 2 antibody, KIAA0971 antibody
Specificity FASTKD2 antibody was raised against the middle region of FASTKD2
Cross Reactivity Human
Applications WB
Immunogen FASTKD2 antibody was raised using the middle region of FASTKD2 corresponding to a region with amino acids DTNRNQVLPLSDVDTTSATDIQRVAVLCVSRSAYCLGSSHPRGFLAMKMR
Assay Information FASTKD2 Blocking Peptide, catalog no. 33R-2200, is also available for use as a blocking control in assays to test for specificity of this FASTKD2 antibody


Western Blot analysis using FASTKD2 antibody (70R-3176)

FASTKD2 antibody (70R-3176) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 81 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FASTKD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein that is localized in the mitochondrial inner compartment and that may play a role in mitochondrial apoptosis. Nonsense mutations have been reported to result in cytochrome c oxidase deficiency.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FASTKD2 antibody (70R-3176) | FASTKD2 antibody (70R-3176) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors