FBP1 antibody (70R-1222)

Rabbit polyclonal FBP1 antibody raised against the N terminal of FBP1

Synonyms Polyclonal FBP1 antibody, Anti-FBP1 antibody, FBP antibody, Fructose-16-Bisphosphatase 1 antibody
Specificity FBP1 antibody was raised against the N terminal of FBP1
Cross Reactivity Human,Mouse
Applications IHC, WB
Immunogen FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA
Assay Information FBP1 Blocking Peptide, catalog no. 33R-10289, is also available for use as a blocking control in assays to test for specificity of this FBP1 antibody


Immunohistochemical staining using FBP1 antibody (70R-1222)

FBP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FBP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.Fructose-1,6-bisphosphatase 1, a gluconeogenesis regulatory enzyme, catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate and inorganic phosphate. Fructose-1,6-diphosphatase deficiency is associated with hypoglycemia and metabolic acidosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using FBP1 antibody (70R-1222) | FBP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using FBP1 antibody (70R-1222) | FBP1 antibody (70R-1222) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using FBP1 antibody (70R-1222) | FBP1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors