FBXL11 Blocking Peptide (33R-7980)

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL11 antibody, catalog no. 70R-7879

Synonyms FBXL11 control peptide, FBXL11 antibody Blocking Peptide, Anti-FBXL11 Blocking Peptide, F-box and leucine-rich repeat protein 11 Blocking Peptide, FBXL11, FBXL-11, FBXL 11, FBXL-11 Blocking Peptide, FBXL 11 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTF
Molecular Weight 86 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXL11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box). The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL11 belongs to the Fbls class and, in addition to an F-box, contains at least 6 highly degenerated leucine-rich repeats

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors