FBXL11 Blocking Peptide (33R-7980)
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXL11 antibody, catalog no. 70R-7879
Overview
Overview
| Synonyms | FBXL11 control peptide, FBXL11 antibody Blocking Peptide, Anti-FBXL11 Blocking Peptide, F-box and leucine-rich repeat protein 11 Blocking Peptide, FBXL11, FBXL-11, FBXL 11, FBXL-11 Blocking Peptide, FBXL 11 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHTNKYNANFVTF |
|---|---|
| Molecular Weight | 86 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | FBXL11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box). The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL11 belongs to the Fbls class and, in addition to an F-box, contains at least 6 highly degenerated leucine-rich repeats |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product