FBXL3 antibody (70R-2129)
Rabbit polyclonal FBXL3 antibody raised against the middle region of FBXL3
Overview
Overview
Synonyms | Polyclonal FBXL3 antibody, Anti-FBXL3 antibody, FBXL3A antibody, FBXL 3, FBL3A antibody, FBL3 antibody, FBXL-3, FBXL 3 antibody, F-Box And Leucine-Rich Repeat Protein 3 antibody, FBXL3, FBXL-3 antibody |
---|---|
Specificity | FBXL3 antibody was raised against the middle region of FBXL3 |
Cross Reactivity | Human,Mouse,Rat |
Applications | WB |
Immunogen | FBXL3 antibody was raised using the middle region of FBXL3 corresponding to a region with amino acids LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV |
Assay Information | FBXL3 Blocking Peptide, catalog no. 33R-5067, is also available for use as a blocking control in assays to test for specificity of this FBXL3 antibody |
Images
Western Blot analysis using FBXL3 antibody (70R-2129)
FBXL3 antibody (70R-2129) used at 1 ug/ml to detect target protein.
Specifications
Host | Rabbit |
---|---|
Method of Purification | Affinity purified |
Molecular Weight | 47 kDa (MW of target protein) |
Form & Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXL3 antibody in PBS |
Concentration | 1 mg/ml |
Usage & Assay Information
Usage Recommendations | WB: 1 ug/ml |
---|
Storage & Safety
Storage | Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles. |
---|
General Information
Biological Significance | FBXL3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus. |
---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product