FBXL3 antibody (70R-2129)

Rabbit polyclonal FBXL3 antibody raised against the middle region of FBXL3

Synonyms Polyclonal FBXL3 antibody, Anti-FBXL3 antibody, FBXL3A antibody, FBXL 3, FBL3A antibody, FBL3 antibody, FBXL-3, FBXL 3 antibody, F-Box And Leucine-Rich Repeat Protein 3 antibody, FBXL3, FBXL-3 antibody
Specificity FBXL3 antibody was raised against the middle region of FBXL3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FBXL3 antibody was raised using the middle region of FBXL3 corresponding to a region with amino acids LISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV
Assay Information FBXL3 Blocking Peptide, catalog no. 33R-5067, is also available for use as a blocking control in assays to test for specificity of this FBXL3 antibody


Western Blot analysis using FBXL3 antibody (70R-2129)

FBXL3 antibody (70R-2129) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXL3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXL3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein belongs to the Fbls class and, in addition to an F-box, contains several tandem leucine-rich repeats and is localized in the nucleus.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXL3 antibody (70R-2129) | FBXL3 antibody (70R-2129) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors