FBXL7 antibody (70R-1164)

Rabbit polyclonal FBXL7 antibody raised against the N terminal of FBXL7

Synonyms Polyclonal FBXL7 antibody, Anti-FBXL7 antibody, FBXL 7, FBXL 7 antibody, FBL7 antibody, FBXL7, FBXL-7 antibody, FBXL-7, F-Box And Leucine-Rich Repeat Protein 7 antibody, FBL6 antibody
Specificity FBXL7 antibody was raised against the N terminal of FBXL7
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen FBXL7 antibody was raised using the N terminal of FBXL7 corresponding to a region with amino acids IRLASRPQKEQASIDRLPDHSMVQIFSFLPTNQLCRCARVCRRWYNLAWD
Assay Information FBXL7 Blocking Peptide, catalog no. 33R-4136, is also available for use as a blocking control in assays to test for specificity of this FBXL7 antibody

Images

Immunohistochemical staining using FBXL7 antibody (70R-1164)

FBXL7 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FBXL7 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXL7 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using FBXL7 antibody (70R-1164) | FBXL7 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using FBXL7 antibody (70R-1164) | FBXL7 antibody (70R-1164) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors