FBXO10 antibody (70R-3607)

Rabbit polyclonal FBXO10 antibody raised against the middle region of FBXO10

Synonyms Polyclonal FBXO10 antibody, Anti-FBXO10 antibody, FLJ41992 antibody, FBX10 antibody, FBXO 10, F-Box Protein 10 antibody, FBXO-10, FBXO-10 antibody, MGC149840 antibody, FBXO10, FBXO 10 antibody
Specificity FBXO10 antibody was raised against the middle region of FBXO10
Cross Reactivity Human
Applications WB
Immunogen FBXO10 antibody was raised using the middle region of FBXO10 corresponding to a region with amino acids SSSPKPGSKAGSQEAEVGSDGERVAQTPDSSDGGLSPSGEDEDEDQLMYR
Assay Information FBXO10 Blocking Peptide, catalog no. 33R-8851, is also available for use as a blocking control in assays to test for specificity of this FBXO10 antibody


Western Blot analysis using FBXO10 antibody (70R-3607)

FBXO10 antibody (70R-3607) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 105 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the F-box protein family, such as FBXO10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO10 antibody (70R-3607) | FBXO10 antibody (70R-3607) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors