FBXO24 antibody (70R-2248)

Rabbit polyclonal FBXO24 antibody raised against the N terminal of FBXO24

Synonyms Polyclonal FBXO24 antibody, Anti-FBXO24 antibody, FBX24 antibody, FBXO-24 antibody, FBXO-24, FBXO 24 antibody, FBXO24, F-Box Protein 24 antibody, DKFZp434I1122 antibody, FBXO 24
Specificity FBXO24 antibody was raised against the N terminal of FBXO24
Cross Reactivity Human
Applications WB
Immunogen FBXO24 antibody was raised using the N terminal of FBXO24 corresponding to a region with amino acids VCDGEGVWRRICRRLSPRLQDQDTKGLYFQAFGGRRRCLSKSVAPLLAHG
Assay Information FBXO24 Blocking Peptide, catalog no. 33R-9447, is also available for use as a blocking control in assays to test for specificity of this FBXO24 antibody


Western Blot analysis using FBXO24 antibody (70R-2248)

FBXO24 antibody (70R-2248) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO24 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO24 antibody (70R-2248) | FBXO24 antibody (70R-2248) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors