FBXO3 Blocking Peptide (33R-6651)

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO3 antibody, catalog no. 70R-2789

Synonyms FBXO3 control peptide, FBXO3 antibody Blocking Peptide, Anti-FBXO3 Blocking Peptide, F-Box Protein 3 Blocking Peptide, DKFZp564B092 Blocking Peptide, FBA Blocking Peptide, FBX3 Blocking Peptide, FBXO3, FBXO-3, FBXO 3, FBXO-3 Blocking Peptide, FBXO 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS
Molecular Weight 47 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO3 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO3 belongs to the Fbxs class.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors