FBXO31 antibody (70R-2500)

Rabbit polyclonal FBXO31 antibody raised against the middle region of FBXO31

Synonyms Polyclonal FBXO31 antibody, Anti-FBXO31 antibody, Fbx31 antibody, pp2386 antibody, FBXO14 antibody, FBX14 antibody, FBXO31, MGC9527 antibody, F-Box Protein 31 antibody, FLJ22477 antibody, FBXO-31 antibody, FBXO 31 antibody, DKFZp434J1815 antibody, FBXO 31, FBXO-31, DKFZP434B027 antibody, MGC15419 antibody
Specificity FBXO31 antibody was raised against the middle region of FBXO31
Cross Reactivity Human,Mouse
Applications WB
Immunogen FBXO31 antibody was raised using the middle region of FBXO31 corresponding to a region with amino acids VAAAEQPAQCGQGQPFVLPVGVSSRNEDYPRTCRMCFYGTGLIAGHGFTS
Assay Information FBXO31 Blocking Peptide, catalog no. 33R-9406, is also available for use as a blocking control in assays to test for specificity of this FBXO31 antibody


Western Blot analysis using FBXO31 antibody (70R-2500)

FBXO31 antibody (70R-2500) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO31 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO31 is the component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in G1 arrest following DNA damage. FBXO31 specifically recognises phosphorylated cyclin-D1 (CCND1), promoting its ubiquitination and degradation by the proteasome, resulting in G1 arrest.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO31 antibody (70R-2500) | FBXO31 antibody (70R-2500) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors