FBXO34 antibody (70R-3482)

Rabbit polyclonal FBXO34 antibody raised against the middle region of FBXO34

Synonyms Polyclonal FBXO34 antibody, Anti-FBXO34 antibody, Fbx34 antibody, F-Box Protein 34 antibody, FBXO 34 antibody, MGC126435 antibody, FBXO 34, CGI-301 antibody, DKFZp547C162 antibody, FBXO-34 antibody, FLJ20725 antibody, FBXO-34, FBXO34, MGC126434 antibody
Specificity FBXO34 antibody was raised against the middle region of FBXO34
Cross Reactivity Human
Applications WB
Immunogen FBXO34 antibody was raised using the middle region of FBXO34 corresponding to a region with amino acids ESECLKRQGQREPGSLSRNNSFRRNVGRVLLANSTQADEGKTKKGVLEAP
Assay Information FBXO34 Blocking Peptide, catalog no. 33R-2722, is also available for use as a blocking control in assays to test for specificity of this FBXO34 antibody


Western Blot analysis using FBXO34 antibody (70R-3482)

FBXO34 antibody (70R-3482) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 79 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO34 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the F-box protein family, such as FBXO34, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO34 antibody (70R-3482) | FBXO34 antibody (70R-3482) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors