FBXO39 Blocking Peptide (33R-8114)

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO39 antibody, catalog no. 70R-3431

Synonyms FBXO39 control peptide, FBXO39 antibody Blocking Peptide, Anti-FBXO39 Blocking Peptide, F-Box Protein 39 Blocking Peptide, Fbx39 Blocking Peptide, MGC35179 Blocking Peptide, FBXO39, FBXO-39, FBXO 39, FBXO-39 Blocking Peptide, FBXO 39 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RQCALRVFKARIYTNRYETNEEDKTLQEIYRKYRKLIESELSYFVIVYSV
Molecular Weight 53 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO39 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors