FBXO39 Blocking Peptide (33R-8114)
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXO39 antibody, catalog no. 70R-3431
Overview
Overview
| Synonyms | FBXO39 control peptide, FBXO39 antibody Blocking Peptide, Anti-FBXO39 Blocking Peptide, F-Box Protein 39 Blocking Peptide, Fbx39 Blocking Peptide, MGC35179 Blocking Peptide, FBXO39, FBXO-39, FBXO 39, FBXO-39 Blocking Peptide, FBXO 39 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RQCALRVFKARIYTNRYETNEEDKTLQEIYRKYRKLIESELSYFVIVYSV |
|---|---|
| Molecular Weight | 53 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | FBXO39 is the substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.Members of the F-box protein family, such as FBXO39, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product