FBXO8 antibody (70R-3127)

Rabbit polyclonal FBXO8 antibody raised against the middle region of FBXO8

Synonyms Polyclonal FBXO8 antibody, Anti-FBXO8 antibody, FBXO-8 antibody, DC10 antibody, FBXO 8 antibody, F-Box Protein 8 antibody, FBXO-8, FBXO8, FBXO 8, FBX8 antibody, FBS antibody
Specificity FBXO8 antibody was raised against the middle region of FBXO8
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FBXO8 antibody was raised using the middle region of FBXO8 corresponding to a region with amino acids EFFRHIHAPEERGEYLETLITKFSHRFCACNPDLMRELGLSPDAVYVLCY
Assay Information FBXO8 Blocking Peptide, catalog no. 33R-2402, is also available for use as a blocking control in assays to test for specificity of this FBXO8 antibody


Western Blot analysis using FBXO8 antibody (70R-3127)

FBXO8 antibody (70R-3127) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FBXO8 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FBXO8 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO8 belongs to the Fbxs class.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FBXO8 antibody (70R-3127) | FBXO8 antibody (70R-3127) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors