FBXW10 Blocking Peptide (33R-7996)

A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW10 antibody, catalog no. 70R-3251

Synonyms FBXW10 control peptide, FBXW10 antibody Blocking Peptide, Anti-FBXW10 Blocking Peptide, F-Box And Wd Repeat Domain Containing 10 Blocking Peptide, Fbw10 Blocking Peptide, HREP Blocking Peptide, SM25H2 Blocking Peptide, SM2SH2 Blocking Peptide, FBXW10, FBXW-10, FBXW 10, FBXW-10 Blocking Peptide, FBXW 10 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RKIHLLDIIQVKAIPVEFRGHAGSVRALFLCEEENFLLSGSYDLSIRYWD
Molecular Weight 120 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors