FBXW10 Blocking Peptide (33R-8670)
A synthetic peptide for use as a blocking control in assays to test for specificity of FBXW10 antibody, catalog no. 70R-3250
Overview
Overview
| Synonyms | FBXW10 control peptide, FBXW10 antibody Blocking Peptide, Anti-FBXW10 Blocking Peptide, F-Box And Wd Repeat Domain Containing 10 Blocking Peptide, Fbw10 Blocking Peptide, HREP Blocking Peptide, SM25H2 Blocking Peptide, SM2SH2 Blocking Peptide, FBXW10, FBXW-10, FBXW 10, FBXW-10 Blocking Peptide, FBXW 10 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SPEKDHSSKSATSQVYWTAKTQHTSLPLSKAPENEHLLGAASNPEEPWRN |
|---|---|
| Molecular Weight | 120 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Members of the F-box protein family, such as FBXW10, are characterized by an approximately 40-amino acid F-box motif. SCF complexes, formed by SKP1, cullin, and F-box proteins, act as protein-ubiquitin ligases. F-box proteins interact with SKP1 through the F box, and they interact with ubiquitination targets through other protein interaction domains. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product