FEN1 antibody (70R-1605)

Rabbit polyclonal FEN1 antibody raised against the C terminal of FEN1

Synonyms Polyclonal FEN1 antibody, Anti-FEN1 antibody, RAD2 antibody, MF1 antibody, Flap Structure-Specific Endonuclease 1 antibody, FEN-1 antibody
Specificity FEN1 antibody was raised against the C terminal of FEN1
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen FEN1 antibody was raised using the C terminal of FEN1 corresponding to a region with amino acids PNEEELIKFMCGEKQFSEERIRSGVKRLSKSRQGSTQGRLDDFFKVTGSL
Assay Information FEN1 Blocking Peptide, catalog no. 33R-7232, is also available for use as a blocking control in assays to test for specificity of this FEN1 antibody


Western Blot analysis using FEN1 antibody (70R-1605)

FEN1 antibody (70R-1605) used at 1.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FEN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FEN1 removes 5' overhanging flaps in DNA repair and processes the 5' ends of Okazaki fragments in lagging strand DNA synthesis. Direct physical interaction between this protein and AP endonuclease 1 during long-patch base excision repair provides coordinated loading of the proteins onto the substrate, thus passing the substrate from one enzyme to another. The protein is a member of the XPG/RAD2 endonuclease family and is one of ten proteins essential for cell-free DNA replication. DNA secondary structure can inhibit flap processing at certain trinucleotide repeats in a length-dependent manner by concealing the 5' end of the flap that is necessary for both binding and cleavage by the protein encoded by this gene. Therefore, secondary structure can deter the protective function of this protein, leading to site-specific trinucleotide expansions.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FEN1 antibody (70R-1605) | FEN1 antibody (70R-1605) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors