FGFR1OP antibody (70R-3624)

Rabbit polyclonal FGFR1OP antibody raised against the middle region of FGFR1OP

Synonyms Polyclonal FGFR1OP antibody, Anti-FGFR1OP antibody, FOP antibody, FGFR1OP, FGFROP-1 antibody, FGFROP-1, FGFROP 1, Fgfr1 Oncogene Partner antibody, FGFROP 1 antibody
Specificity FGFR1OP antibody was raised against the middle region of FGFR1OP
Cross Reactivity Human
Applications WB
Immunogen FGFR1OP antibody was raised using the middle region of FGFR1OP corresponding to a region with amino acids LSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEAN
Assay Information FGFR1OP Blocking Peptide, catalog no. 33R-5417, is also available for use as a blocking control in assays to test for specificity of this FGFR1OP antibody

Images

Western Blot analysis using FGFR1OP antibody (70R-3624)

FGFR1OP antibody (70R-3624) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FGFR1OP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FGFR1OP is a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t (6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using FGFR1OP antibody (70R-3624) | FGFR1OP antibody (70R-3624) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
OR
Shipping
View Our Distributors