FGFR2 Blocking Peptide (33R-4588)

A synthetic peptide for use as a blocking control in assays to test for specificity of FGFR2 antibody, catalog no. 70R-9972

Synonyms FGFR2 control peptide, FGFR2 antibody Blocking Peptide, Anti-FGFR2 Blocking Peptide, fibroblast growth factor receptor 2 Blocking Peptide, BEK Blocking Peptide, BFR-1 Blocking Peptide, CD332 Blocking Peptide, CEK3 Blocking Peptide, CFD1 Blocking Peptide, ECT1 Blocking Peptide, FLJ98662 Blocking Peptide, JWS Blocking Peptide, K-SAM Blocking Peptide, KGFR Blocking Peptide, TK14 Blocking Peptide, TK25 Blocking Peptide, FGFR2, FGFR-2, FGFR 2, FGFR-2 Blocking Peptide, FGFR 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues KPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQ
Molecular Weight 78 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors