FGFR2 Blocking Peptide (33R-4588)
A synthetic peptide for use as a blocking control in assays to test for specificity of FGFR2 antibody, catalog no. 70R-9972
Overview
Overview
| Synonyms | FGFR2 control peptide, FGFR2 antibody Blocking Peptide, Anti-FGFR2 Blocking Peptide, fibroblast growth factor receptor 2 Blocking Peptide, BEK Blocking Peptide, BFR-1 Blocking Peptide, CD332 Blocking Peptide, CEK3 Blocking Peptide, CFD1 Blocking Peptide, ECT1 Blocking Peptide, FLJ98662 Blocking Peptide, JWS Blocking Peptide, K-SAM Blocking Peptide, KGFR Blocking Peptide, TK14 Blocking Peptide, TK25 Blocking Peptide, FGFR2, FGFR-2, FGFR 2, FGFR-2 Blocking Peptide, FGFR 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | KPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKMIGKHKNIINLLGACTQ |
|---|---|
| Molecular Weight | 78 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene is a member of the fibroblast growth factor receptor family, where amino acid sequence is highly conserved between members and throughout evolution. FGFR family members differ from one another in their ligand affinities and tissue distribution. A full-length representative protein consists of an extracellular region, composed of three immunoglobulin-like domains, a single hydrophobic membrane-spanning segment and a cytoplasmic tyrosine kinase domain. The extracellular portion of the protein interacts with fibroblast growth factors, setting in motion a cascade of downstream signals, ultimately influencing mitogenesis and differentiation. This particular family member is a high-affinity receptor for acidic, basic and/or keratinocyte growth factor, depending on the isoform. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product