FGL2 antibody (70R-4461)

Rabbit polyclonal FGL2 antibody raised against the middle region of FGL2

Synonyms Polyclonal FGL2 antibody, Anti-FGL2 antibody, pT49 antibody, Fibrinogen-Like 2 antibody, T49 antibody
Specificity FGL2 antibody was raised against the middle region of FGL2
Cross Reactivity Human
Applications WB
Immunogen FGL2 antibody was raised using the middle region of FGL2 corresponding to a region with amino acids WTVLQARLDGSTNFTRTWQDYKAGFGNLRREFWLGNDKIHLLTKSKEMIL
Assay Information FGL2 Blocking Peptide, catalog no. 33R-10030, is also available for use as a blocking control in assays to test for specificity of this FGL2 antibody


Western Blot analysis using FGL2 antibody (70R-4461)

FGL2 antibody (70R-4461) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FGL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a secreted protein that is similar to the beta- and gamma-chains of fibrinogen. The carboxyl-terminus of the encoded protein consists of the fibrinogen-related domains (FRED). The encoded protein forms a tetrameric complex which is stabilized by interchain disulfide bonds. This protein may play a role in physiologic functions at mucosal sites.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FGL2 antibody (70R-4461) | FGL2 antibody (70R-4461) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors