FGR antibody (70R-3655)

Rabbit polyclonal FGR antibody

Synonyms Polyclonal FGR antibody, Anti-FGR antibody, MGC75096 antibody, V-Fgr Oncogene Homolog antibody, c-fgr antibody, FLJ43153 antibody, p55c-fgr antibody, SRC2 antibody, Gardner-Rasheed Feline Sarcoma Viral antibody, c-src2 antibody, p58c-fgr antibody
Cross Reactivity Human
Applications WB
Immunogen FGR antibody was raised using a synthetic peptide corresponding to a region with amino acids CPPGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQ
Assay Information FGR Blocking Peptide, catalog no. 33R-1770, is also available for use as a blocking control in assays to test for specificity of this FGR antibody


Western Blot analysis using FGR antibody (70R-3655)

FGR antibody (70R-3655) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FGR antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FGR antibody (70R-3655) | FGR antibody (70R-3655) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors