FHL2 Blocking Peptide (33R-7909)
A synthetic peptide for use as a blocking control in assays to test for specificity of FHL2 antibody, catalog no. 20R-1089
Overview
Overview
| Synonyms | FHL2 control peptide, FHL2 antibody Blocking Peptide, Anti-FHL2 Blocking Peptide, four and a half LIM domains 2 Blocking Peptide, FHL2, FHL-2, FHL 2, FHL-2 Blocking Peptide, FHL 2 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC |
|---|---|
| Molecular Weight | 32 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | FHL2 is a member of LIM proteins that contain a highly conserved double zinc finger motif called the LIM domain. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product