FHL2 Blocking Peptide (33R-7909)

A synthetic peptide for use as a blocking control in assays to test for specificity of FHL2 antibody, catalog no. 20R-1089

Synonyms FHL2 control peptide, FHL2 antibody Blocking Peptide, Anti-FHL2 Blocking Peptide, four and a half LIM domains 2 Blocking Peptide, FHL2, FHL-2, FHL 2, FHL-2 Blocking Peptide, FHL 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues RFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFEERQWHNDC
Molecular Weight 32 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FHL2 is a member of LIM proteins that contain a highly conserved double zinc finger motif called the LIM domain.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors