Fibronectin 1 antibody (70R-2231)

Rabbit polyclonal Fibronectin 1 antibody raised against the C terminal of FN1

Synonyms Polyclonal Fibronectin 1 antibody, Anti-Fibronectin 1 antibody, FINC antibody, DKFZp686H0342 antibody, CIG antibody, DKFZp686O13149 antibody, MSF antibody, FN1 antibody, DKFZp686I1370 antibody, DKFZp686F10164 antibody, LETS antibody, FN antibody
Specificity Fibronectin 1 antibody was raised against the C terminal of FN1
Cross Reactivity Human,Dog
Applications WB
Immunogen Fibronectin 1 antibody was raised using the C terminal of FN1 corresponding to a region with amino acids NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR
Assay Information Fibronectin 1 Blocking Peptide, catalog no. 33R-6655, is also available for use as a blocking control in assays to test for specificity of this Fibronectin 1 antibody


Western Blot analysis using Fibronectin 1 antibody (70R-2231)

Fibronectin 1 antibody (70R-2231) used at 0.25 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 76 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Fibronectin 1 antibody (70R-2231) | Fibronectin 1 antibody (70R-2231) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors