FICD antibody (70R-1636)

Rabbit polyclonal FICD antibody raised against the C terminal Of Ficd

Synonyms Polyclonal FICD antibody, Anti-FICD antibody, HYPE antibody, hip13 antibody, UNQ3041 antibody, MGC5623 antibody
Specificity FICD antibody was raised against the C terminal Of Ficd
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen FICD antibody was raised using the C terminal Of Ficd corresponding to a region with amino acids FAALAHYKLVYIHPFIDGNGRTSRLLMNLILMQAGYPPITIRKEQRSDYY
Assay Information FICD Blocking Peptide, catalog no. 33R-2836, is also available for use as a blocking control in assays to test for specificity of this FICD antibody

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FICD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FICD is an adenylyltransferase that mediates the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins. It is able to inactivate Rho GTPases in vitro by adding AMP to RhoA, Rac and Cdc42. It is however unclear whether it inactivates GTPases in vivo and physiological substrates probably remain to be identified.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €258.73
Size: 100 ug
OR
Shipping
View Our Distributors