FKBP3 antibody (70R-2287)

Rabbit polyclonal FKBP3 antibody raised against the C terminal of FKBP3

Synonyms Polyclonal FKBP3 antibody, Anti-FKBP3 antibody, FK-506, PPIase antibody, FK 506 antibody, FK506, Fk506 Binding Protein 3 25Kda antibody, FK-506 antibody, FKBP-25 antibody, FK 506
Specificity FKBP3 antibody was raised against the C terminal of FKBP3
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FKBP3 antibody was raised using the C terminal of FKBP3 corresponding to a region with amino acids EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID
Assay Information FKBP3 Blocking Peptide, catalog no. 33R-2266, is also available for use as a blocking control in assays to test for specificity of this FKBP3 antibody


Western Blot analysis using FKBP3 antibody (70R-2287)

FKBP3 antibody (70R-2287) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKBP3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FKBP3 antibody (70R-2287) | FKBP3 antibody (70R-2287) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors