FKBP5 antibody (70R-2377)

Rabbit polyclonal FKBP5 antibody raised against the C terminal of FKBP5

Synonyms Polyclonal FKBP5 antibody, Anti-FKBP5 antibody, FKBP54 antibody, PPIase antibody, P54 antibody, FK-506, FKBP51 antibody, FK-506 antibody, Ptg-10 antibody, FK 506 antibody, Fk506 Binding Protein 5 antibody, MGC111006 antibody, FK506, FK 506
Specificity FKBP5 antibody was raised against the C terminal of FKBP5
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen FKBP5 antibody was raised using the C terminal of FKBP5 corresponding to a region with amino acids CYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLLMNEFESAKGDFE
Assay Information FKBP5 Blocking Peptide, catalog no. 33R-1834, is also available for use as a blocking control in assays to test for specificity of this FKBP5 antibody


Western blot analysis using FKBP5 antibody (70R-2377)

Recommended FKBP5 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKBP5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FKBP5 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. It is a cis-trans prolyl isomerase that binds to the immunosuppressants FK506 and rapamycin. It is thought to mediate calcineurin inhibition. It also interacts functionally with mature hetero-oligomeric progesterone receptor complexes along with the 90 kDa heat shock protein and P23 protein.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using FKBP5 antibody (70R-2377) | Recommended FKBP5 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using FKBP5 antibody (70R-2377) | Brain, cortex

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors