FKBPL Blocking Peptide (33R-1136)
A synthetic peptide for use as a blocking control in assays to test for specificity of FKBPL antibody, catalog no. 70R-3815
Overview
Overview
| Synonyms | FKBPL control peptide, FKBPL antibody Blocking Peptide, Anti-FKBPL Blocking Peptide, Fk506 Binding Protein Like Blocking Peptide, DIR1 Blocking Peptide, NG7 Blocking Peptide, WISP39 Blocking Peptide, FK506, FK-506, FK 506, FK-506 Blocking Peptide, FK 506 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL |
|---|---|
| Molecular Weight | 38 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product