FKBPL Blocking Peptide (33R-1136)

A synthetic peptide for use as a blocking control in assays to test for specificity of FKBPL antibody, catalog no. 70R-3815

Synonyms FKBPL control peptide, FKBPL antibody Blocking Peptide, Anti-FKBPL Blocking Peptide, Fk506 Binding Protein Like Blocking Peptide, DIR1 Blocking Peptide, NG7 Blocking Peptide, WISP39 Blocking Peptide, FK506, FK-506, FK 506, FK-506 Blocking Peptide, FK 506 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL
Molecular Weight 38 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene has similarity to the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. The encoded protein is thought to have a potential role in the induced radioresistance. Also it appears to have some involvement in the control of the cell cycle.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors