FKSG24 antibody (70R-3824)

Rabbit polyclonal FKSG24 antibody raised against the N terminal of FKSG24

Synonyms Polyclonal FKSG24 antibody, Anti-FKSG24 antibody, FKSG24, FKSG-24, MGC110861 antibody, MGC12972 antibody, FKSG 24, Hypothetical Protein Mgc12972 antibody, FKSG-24 antibody, FKSG 24 antibody
Specificity FKSG24 antibody was raised against the N terminal of FKSG24
Cross Reactivity Human
Applications WB
Immunogen FKSG24 antibody was raised using the N terminal of FKSG24 corresponding to a region with amino acids PFLHYWYLSLDRLFPASGLRGFPNVLKKVLVDQLVASPLLGVWYFLGLGC
Assay Information FKSG24 Blocking Peptide, catalog no. 33R-7079, is also available for use as a blocking control in assays to test for specificity of this FKSG24 antibody


Western Blot analysis using FKSG24 antibody (70R-3824)

FKSG24 antibody (70R-3824) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FKSG24 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FKSG24 is a multi-pass membrane proteinPotential. It belongs to the peroxisomal membrane protein PXMP2/4 family. The exact function of FKSG24 remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FKSG24 antibody (70R-3824) | FKSG24 antibody (70R-3824) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors