FLCN Blocking Peptide (33R-10310)

A synthetic peptide for use as a blocking control in assays to test for specificity of FLCN antibody, catalog no. 70R-10331

Synonyms FLCN control peptide, FLCN antibody Blocking Peptide, Anti-FLCN Blocking Peptide, folliculin Blocking Peptide, BHD Blocking Peptide, DKFZp547A118 Blocking Peptide, FLCL Blocking Peptide, FLJ45004 Blocking Peptide, FLJ99377 Blocking Peptide, MGC17998 Blocking Peptide, MGC23445 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues CLKEEWMNKVKVLFKFTKVDSRPKEDTQKLLSILGASEEDNVKLLKFWMT
Molecular Weight 64 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is located within the Smith-Magenis syndrome region on chromosome 17. Mutations in this gene are associated with Birt-Hogg-Dube syndrome, which is characterized by fibrofolliculomas, renal tumors, lung cysts, and pneumothorax.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors