FLJ14213 antibody (70R-1281)

Rabbit polyclonal FLJ14213 antibody raised against the N terminal of FLJ14213

Synonyms Polyclonal FLJ14213 antibody, Anti-FLJ14213 antibody, FLJ-14213, MGC16218 antibody, Hypothetical Protein Flj14213 antibody, FLJ-14213 antibody, FLJ14213, FLJ 14213 antibody, FLJ 14213
Specificity FLJ14213 antibody was raised against the N terminal of FLJ14213
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen FLJ14213 antibody was raised using the N terminal of FLJ14213 corresponding to a region with amino acids SAWNSVQTAVINVFKGGGLQSNELYALNENIRRLLKSELGSFITDYFQNQ
Assay Information FLJ14213 Blocking Peptide, catalog no. 33R-8324, is also available for use as a blocking control in assays to test for specificity of this FLJ14213 antibody


Western Blot analysis using FLJ14213 antibody (70R-1281)

FLJ14213 antibody (70R-1281) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of FLJ14213 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FLJ14213 may be part of the TORC2 complex which plays a critical role in AKT1 'Ser-473' phosphorylation, and may modulate the phosphorylation of PKCA and regulate actin cytoskeleton organization

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FLJ14213 antibody (70R-1281) | FLJ14213 antibody (70R-1281) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: €227.26
Size: 100 ug
View Our Distributors