FLJ22167 Blocking Peptide (33R-1707)

A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ22167 antibody, catalog no. 70R-1787

Synonyms FLJ22167 control peptide, FLJ22167 antibody Blocking Peptide, Anti-FLJ22167 Blocking Peptide, Hypothetical Protein Flj22167 Blocking Peptide, ALYE870 Blocking Peptide, PRO1886 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA
Molecular Weight 36 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The FLJ22167 protein catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. FLJ22167 acts on the non-reducing terminal GlcNAc of short carbohydrate substrates.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors