FLJ22167 Blocking Peptide (33R-1707)
A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ22167 antibody, catalog no. 70R-1787
Overview
Overview
| Synonyms | FLJ22167 control peptide, FLJ22167 antibody Blocking Peptide, Anti-FLJ22167 Blocking Peptide, Hypothetical Protein Flj22167 Blocking Peptide, ALYE870 Blocking Peptide, PRO1886 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | CHEAPRARSARAGLPNRLPTALFNSGFWLKRSSYEEQPTVRFQHQVLLVA |
|---|---|
| Molecular Weight | 36 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The FLJ22167 protein catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues and O-linked sugars of mucin-type acceptors. FLJ22167 acts on the non-reducing terminal GlcNAc of short carbohydrate substrates. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product