FLJ30934 Blocking Peptide (33R-8587)
A synthetic peptide for use as a blocking control in assays to test for specificity of FLJ30934 antibody, catalog no. 70R-9331
Overview
Overview
| Synonyms | FLJ30934 control peptide, FLJ30934 antibody Blocking Peptide, Anti-FLJ30934 Blocking Peptide, sorting nexin 32 Blocking Peptide, DKFZp761P1320 Blocking Peptide, MGC42112 Blocking Peptide, MGC57276 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | SLGTQEVNQLRTSFLKLAELFERLRKLEGRVASDEDLKLSDMLRYYMRDS |
|---|---|
| Molecular Weight | 46 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | The function of this protein remains unknown. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product