Fmo3 Blocking Peptide (33R-4593)
A synthetic peptide for use as a blocking control in assays to test for specificity of Fmo3 antibody, catalog no. 70R-8601
Overview
Overview
| Synonyms | Fmo3 control peptide, Fmo3 antibody Blocking Peptide, Anti-Fmo3 Blocking Peptide, flavin containing monooxygenase 3 Blocking Peptide, AW111792 Blocking Peptide, Fmo3, Fmo-3, Fmo 3, Fmo-3 Blocking Peptide, Fmo 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | KPNVKEFTETSAVFEDGTMFEAIDCVIFATGYGYAYPFLDDSIIKSRNNE |
|---|---|
| Molecular Weight | 60 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This protein is involved in the oxidative metabolism of a variety of xenobiotics such as drugs and pesticides. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product