FN3KRP antibody (70R-3288)

Rabbit polyclonal FN3KRP antibody raised against the N terminal of FN3KRP

Synonyms Polyclonal FN3KRP antibody, Anti-FN3KRP antibody, FNKRP-3 antibody, FN3KRP, FNKRP 3, Fructosamine-3-Kinase-Related Protein antibody, FNKRP-3, FNKRP 3 antibody, FLJ12171 antibody
Specificity FN3KRP antibody was raised against the N terminal of FN3KRP
Cross Reactivity Human
Applications WB
Immunogen FN3KRP antibody was raised using the N terminal of FN3KRP corresponding to a region with amino acids MDPGDPAGDPAAGERHRMGRDPLLLLQALQTLWSTRERKQLREEAWRGFA
Assay Information FN3KRP Blocking Peptide, catalog no. 33R-5857, is also available for use as a blocking control in assays to test for specificity of this FN3KRP antibody


Western Blot analysis using FN3KRP antibody (70R-3288)

FN3KRP antibody (70R-3288) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FN3KRP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance FN3KRP phosphorylates psicosamines and ribulosamines, but not fructosamines, on the third carbon of the sugar moiety. Protein-bound psicosamine 3-phosphates and ribulosamine 3-phosphates are unstable and decompose under physiological conditions. Thus phosphorylation leads to deglycation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FN3KRP antibody (70R-3288) | FN3KRP antibody (70R-3288) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors