FTHL17 Blocking Peptide (33R-5656)
A synthetic peptide for use as a blocking control in assays to test for specificity of FTHL17 antibody, catalog no. 70R-6913
Overview
Overview
| Synonyms | FTHL17 control peptide, FTHL17 antibody Blocking Peptide, Anti-FTHL17 Blocking Peptide, Ferritin Heavy Polypeptide-Like 17 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | MAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRGGHICLHDIR |
|---|---|
| Molecular Weight | 21 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product