Ftsj3 Blocking Peptide (33R-7784)
A synthetic peptide for use as a blocking control in assays to test for specificity of Ftsj3 antibody, catalog no. 70R-8798
Overview
Overview
| Synonyms | Ftsj3 control peptide, Ftsj3 antibody Blocking Peptide, Anti-Ftsj3 Blocking Peptide, FtsJ homolog 3, E. coli Blocking Peptide, Ftsj3 Blocking Peptide, Ftsj3, Ftsj-3, Ftsj 3, Ftsj-3 Blocking Peptide, Ftsj 3 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | QVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQRKEQKRNHRRK |
|---|---|
| Molecular Weight | 100 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Although the function of this gene is not known, the existence of this gene is supported by mRNA and EST data. A possible function of the encoded protein can be inferred from amino acid sequence similarity to the E.coli FtsJ protein and to a mouse protein possibly involved in embryogenesis. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product