Ftsj3 Blocking Peptide (33R-7784)

A synthetic peptide for use as a blocking control in assays to test for specificity of Ftsj3 antibody, catalog no. 70R-8798

Synonyms Ftsj3 control peptide, Ftsj3 antibody Blocking Peptide, Anti-Ftsj3 Blocking Peptide, FtsJ homolog 3, E. coli Blocking Peptide, Ftsj3 Blocking Peptide, Ftsj3, Ftsj-3, Ftsj 3, Ftsj-3 Blocking Peptide, Ftsj 3 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues QVTYVVAKKGVGRKVRRPAGVRGHFKVVDSRMKKDQRAQRKEQKRNHRRK
Molecular Weight 100 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Although the function of this gene is not known, the existence of this gene is supported by mRNA and EST data. A possible function of the encoded protein can be inferred from amino acid sequence similarity to the E.coli FtsJ protein and to a mouse protein possibly involved in embryogenesis.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors