FUCA1 antibody (70R-5428)

Rabbit polyclonal FUCA1 antibody raised against the middle region of FUCA1

Synonyms Polyclonal FUCA1 antibody, Anti-FUCA1 antibody, Fucosidase Alpha-L- 1 Tissue antibody
Specificity FUCA1 antibody was raised against the middle region of FUCA1
Cross Reactivity Human,Mouse,Dog
Applications WB
Immunogen FUCA1 antibody was raised using the middle region of FUCA1 corresponding to a region with amino acids TNWPSPVSWNWNSKDVGPHRDLVGELGTALRKRNIRYGLYHSLLEWFHPL
Assay Information FUCA1 Blocking Peptide, catalog no. 33R-9215, is also available for use as a blocking control in assays to test for specificity of this FUCA1 antibody


Western Blot analysis using FUCA1 antibody (70R-5428)

FUCA1 antibody (70R-5428) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 54 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of FUCA1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Alpha-L-fucosidase (EC is a lysosomal enzyme involved in the degradation of fucose-containing glycoproteins and glycolipids. At least 2 separate polymorphic alpha-L-fucosidases are recognised in man.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using FUCA1 antibody (70R-5428) | FUCA1 antibody (70R-5428) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: €285.10
Size: 50 ug
View Our Distributors