FUT8 Blocking Peptide (33R-10364)

A synthetic peptide for use as a blocking control in assays to test for specificity of FUT8 antibody, catalog no. 70R-10178

Synonyms FUT8 control peptide, FUT8 antibody Blocking Peptide, Anti-FUT8 Blocking Peptide, fucosyltransferase 8, alpha, 1, 6 fucosyltransferase Blocking Peptide, MGC26465 Blocking Peptide, FUT8, FUT-8, FUT 8, FUT-8 Blocking Peptide, FUT 8 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues LVQRRITYLQNPKDCSKAKKLVCNINKGCGYGCQLHHVVYCFMIAYGTQR
Molecular Weight 49 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €122.31
Size: 100 ug
OR
Shipping
View Our Distributors