Fxn Blocking Peptide (33R-9164)
A synthetic peptide for use as a blocking control in assays to test for specificity of Fxn antibody, catalog no. 70R-8779
Overview
Overview
| Synonyms | Fxn control peptide, Fxn antibody Blocking Peptide, Anti-Fxn Blocking Peptide, frataxin Blocking Peptide, FA Blocking Peptide, FARR Blocking Peptide, Frda Blocking Peptide, X25 Blocking Peptide |
|---|---|
| Protein Type | Synthetic |
| Applications | IHC, WB |
Specifications
| Residues | TLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVL |
|---|---|
| Molecular Weight | 23 kDa |
| Form & Buffer | Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml. |
Storage & Safety
| Storage | Store at -20 deg C long term. Avoid repeat freeze-thaw cycles. |
|---|
General Information
| Biological Significance | Fxn promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. It may play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. It may be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. It modulates the RNA-binding activity of ACO1. |
|---|
Reviews
You need to be logged in to write a review. Please login here
Sorry there are currently no reviews for this product