Fxn Blocking Peptide (33R-9164)

A synthetic peptide for use as a blocking control in assays to test for specificity of Fxn antibody, catalog no. 70R-8779

Synonyms Fxn control peptide, Fxn antibody Blocking Peptide, Anti-Fxn Blocking Peptide, frataxin Blocking Peptide, FA Blocking Peptide, FARR Blocking Peptide, Frda Blocking Peptide, X25 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues TLDNPSSLDETAYERLAEETLDSLAEFFEDLADKPYTLEDYDVSFGDGVL
Molecular Weight 23 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Fxn promotes the biosynthesis of heme and assembly and repair of iron-sulfur clusters by delivering Fe2+ to proteins involved in these pathways. It may play a role in the protection against iron-catalyzed oxidative stress through its ability to catalyze the oxidation of Fe2+ to Fe3+; the oligomeric form but not the monomeric form has in vitro ferroxidase activity. It may be able to store large amounts of iron in the form of a ferrihydrite mineral by oligomerization. It modulates the RNA-binding activity of ACO1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: €106.34
Size: 100 ug
OR
Shipping
View Our Distributors